Close

TMIE Membrane Protein Introduction

Introduction of TMIE

Transmembrane inner ear expressed protein (TMIE) has one transmembrane domain and a signal peptide, which encoded by human TMIE gene. Human TMIE protein shares 92% sequence identity with mouse homolog, and exhibits no significant nucleotide or deduced amoni acid sequence similarity to other gene. TMIE mainly express on the plasma membrane, and luminal surface of sensory hair cells. It serves as a site of interaction for other molecules through its highly charged C-terminal domain. TMIE protein plays an important role in normal hearing and balance.

Basic Information of TMIE
Protein Name Transmembrane inner ear expressed protein
Gene Name TMIE
Aliases Transmembrane inner ear protein
Organism Homo sapiens (Human)
UniProt ID Q8NEW7
Transmembrane Times 1
Length (aa) 156
Sequence MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSIIITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKKDSVDTVAIKVEEDEKNEAKKKKGEK

Function of TMIE Membrane Protein

Mutation of TMIE in mouse leads to sensory cell defects in the inner ear of spinner, which is a model of human hearing loss deafness autosomal recessive 6. Scientists have reported that TMIE is important for normal hearing and vestibular. The location on the cellular membrane of TMIE indicates it plays a role in signal transduction in the auditory system, and the presence in the stereocilia suggests it might have effects on maintaining the structure and function of the specialized microvilli. TMIE also serves as an essential component of the hair cell’s mechanotransduction machinery that functionally couples the tip link to the transduction channel.

TMIE Membrane Protein IntroductionFig.1. Schematic representation of TMIE. (Ganapathy, 2014)

Application of TMIE Membrane Protein in Literature

  1. Ganapathy A., et al. Non-syndromic hearing impairment in India: high allelic heterogeneity among mutations in TMPRSS3, TMC1, USHIC, CDH23 and TMIE. 2014, Plos one. 9(1): e84773. PubMed ID: 24416283.

    This article identified TMPRSS3, TMC1, USHIC, CDH23, and TMIE gene, and concluded that all these five genes mutations made great contribution to non-syndromic hearing loss.

  2. Michelle R., et al. The transmembrane inner ear (Tmie) protein is essential for normal hearing and balance in the zebrafish. Proceedings of the National Academy of Sciences of the United States of America. 2009, 106(50): 1347-21352. PubMed ID: 19934034

    The researchers investigated the role of the TMIE in mechanoelectrical transduction through a line of deaf and uncoordinated zebrafish with defective hair-cell function and found that the TMIE protein was essential for normal hearing and balance.

  3. Zhao B., et al. TMIE is an essential component of the mechanotransduction machinery of cochlear hair cells. Neuron. 2014, 84(5): 954-967. PubMed ID: 25467981

    This article indicated that TMIE was an essential component of the hair cell’s mechanotransduction machinery. And the complex formed by PCDH15, TMHS/LHFPL5, and TMIE was important for regulation of channel properties in different hair cells and along the cochlea’s tonotopic axis.

  4. Liedtke W. A precisely defined role for the tip link-associated protein TMIE in the mechanoelectrical transduction channel complex of inner ear hair cells. Neuron. 2014, 84(5): 889-891. PubMed ID: 25475183

    This article elucidated the mechanistic role of TMIE and how specifically it contributed to mechanoelectrical transduction of inner ear hair cells based on the research in 2014 by Zhao et al.

  5. Karuppasamy S., et al. Subcellular localization of the transmembrane inner ear (Tmie) protein in a stable Tmie-expressing cell line. Laboratory animal research. 2011, 27(4): 339-342. PubMed ID: 22232643

    The researchers developed a stable cell line expressing TMIE and found that it mostly localized on the cellular membrane and to a lesser extent in cytoplasm.

TMIE Preparation Options

In order to meet every client’s requirements, we have developed advanced MemDX™ membrane protein production platform which enables us to provide both reconstitution forms and multiple active formats to obtain functional target proteins. Our professional scientists will work closely with you and help you find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-TMIE antibody development services.


Creative Biolabs offers a series of membrane protein preparation services for your research needs. Our experienced scientists will do their best to meet every client’s specific requirements. To get more information, please feel free to contact us and get a quote.

Reference

  1. Ganapathy A, et al. (2014). Non-syndromic hearing impairment in India: high allelic heterogeneity among mutations in TMPRSS3, TMC1, USHIC, CDH23 and TMIE. Plos One. 9(1), e84773.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us