Blue-sensitive opsin is a protein that in humans is encoded by the OPN1SW gene. It is light-sensitive via the chromophore retinal found in photoreceptor cells of the retina. This protein involves in vision and mediates the conversion of a photon of light into an electrochemical signal, which is the first step in the visual transduction cascade. It has been reported that OPN1SW may be also involved in circadian rhythms and pupillary reflex but not in image-forming.
| Basic Information of OPN1SW | |
| Protein Name | Short-wave-sensitive (SWS) opsin 1 |
| Gene Name | OPN1SW |
| Aliases | Blue cone photoreceptor pigment, Blue-sensitive opsin (BOP) |
| Organism | Homo sapiens (Human) |
| UniProt ID | P03999 |
| Transmembrane Times | 7 |
| Length (aa) | 348 |
| Sequence | MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN |
In several nocturnal primate and mammalian lineages, the OPN1SW gene (coding for SWS visual pigments, sometimes referred to as the SWS1 opsin gene) has accumulated deleterious mutations, resulting in loss of SWS cones and functional color vision. A recent analysis of OPN1SW in nocturnal strepsirrhine primates identified variation in the type of selection acting on this locus. Although researchers have found evidence of relaxed selection on OPN1SW in monochromatic lorises and galagos, most nocturnal lemurs exhibited lower lineage-specific substitution rates for nonsynonymous sites than for synonymous (presumed neutral) sites, reflecting a long-term signature of purifying selection to maintain gene function. The functional OPN1SW gene and signatures of purifying selection indicate recent transitions to nocturnality.
Fig.1 Gene expression pattern of the OPN1SW gene.
The results of this study suggest that open canopy species generally experience strong purifying selection to maintain SWS cones. Authors also find evidence of nonfunctional OPN1SW genes in all Phaner species and in Cheirogaleus medius, implying at least three independent losses of SWS cones in cheirogaleids.
This article establishes that “priming” of neutrophils might be directly related to opsin-upregulation and the opsin physiology/pathophysiology of blood improves diagnosis and therapy of many diseases.
This study finds that the color vision of T. bancanus is advantageous for discriminating prey under twilight that is enriched in shorter (bluer) wavelengths.
We keep in a leading position of membrane protein studies over the past few years. Based on our versatile MemDX™ membrane protein production platform, we can provide a series of advanced membrane protein preparation services in reconstitution forms as well as multiple active formats for worldwide customers. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-OPN1SW antibody development services.
During the past years, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. It's our responsibility to boost the development of our clients' programs with our experienced service. For more details, please feel free to contact us.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.