All products and services are For Research Use Only and CANNOT be used in the treatment or diagnosis of disease.
This product is the plasmid containing an encoded anti-CDH1 DMAb sequence. The plasmid can drive transcription and in vivo translation of the desired antibody.
Sub CAT. | DMAb Clone | DMAb Host | Target Species | DMAb Isotype | DMAb Immunogen | |
DMAb-0014-FY | 24E10 | Rabbit | IgG | |||
DMAb-0015-FY | 67A4 | Mouse | IgG1 | |||
DMAb-0016-FY | 967717 | Mouse | Human | IgG2a | Human embryonic kidney cell line HEK293-derived transfected with human E-Cadherin | |
DMAb-0017-FY | AR38.2 | Mouse | IgG1 | Recombinant Fizzy Related Protein | ||
DMAb-0018-FY | CDH1/1121 | Mouse | Human | IgG1, κ | Recombinant fragment of human E-Cadherin protein | |
DMAb-0019-FY | CDH1/1525 | Mouse | Human | IgG1, κ | Recombinant human full-length E-Cadherin protein | |
DMAb-0020-FY | CL1172 | Mouse | Human | IgG1 | This antibody was developed against a recombinant protein corresponding to amino acids: ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA | |
DMAb-0021-FY | DECMA-1 | Rat | IgG1 | |||
DMAb-0022-FY | ECCD-1 | Rat | Mouse | IgG2b | Mouse teratocarcinoma cell line F9 | |
DMAb-0023-FY | ECCD-2 | Rat | Mouse | IgG2a | Mouse liver E-cadherin fragment | |
DMAb-0024-FY | EP700Y | Rabbit | Human | IgG | ||
DMAb-0025-FY | HECD-1 | Mouse | Human | IgG1 | Human breast tumor cell line MCF-7 | |
DMAb-0026-FY | NCH-38 | Mouse | IgG1, κ | E-cadherin and GST recombinant protein | ||
DMAb-0027-FY | SHE78-7 | Mouse | Human | IgG2a | Soluble E-cadherin from human placenta | |
DMAb-0028-FY | SPM381 | Mouse | Human | IgG1, κ | Recombinant human full-length E-Cadherin protein | |
DMAb-0360-CQ | CDH1/1122 | Mouse | Human | IgG1, κ | ||
DMAb-0361-CQ | DH01 | Mouse | Human | IgG1, κ | ||
DMAb-0367-CQ | 813CT11.1.3 | Mouse | Human | IgG1 | Purified His-tagged CDH1 protein | |
DMAb-0369-CQ | MB2 | Mouse | Human | IgG2b | ||
DMAb-097-YC | GT477 | Mouse | Human | IgG2a | Recombinant protein encompassing a sequence within the center region of human E-Cadherin. | |
DMAb-098-YC | GT311 | Mouse | Human | IgG1 | Recombinant protein encompassing a sequence within the center region of human E-Cadherin. | |
DMAb-099-YC | GT358 | Mouse | Human | IgG2b | Recombinant protein encompassing a sequence within the center region of human E-Cadherin. |
There are currently no customer reviews or questions for Anti-CDH1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-2784-FY). Click the button below to contact us or submit your feedback about this product.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
For any technical issues or product/service related questions, please leave your information below. Our team will contact you soon.
The latest newsletter to introduce the latest breaking information, our site updates, field and other scientific news, important events, and insights from industry leaders
LEARN MORE NEWSLETTERCellRapeutics™ In Vivo Cell Engineering: One-stop in vivo T/B/NK cell and macrophage engineering services covering vectors construction to function verification.
LEARN MORE SOLUTIONSilence™ CAR-T Cell: A novel platform to enhance CAR-T cell immunotherapy by combining RNAi technology to suppress genes that may impede CAR functionality.
LEARN MORE NOVEL TECHNOLOGYCanine CAR-T Therapy Development: From early target discovery, CAR design and construction, cell culture, and transfection, to in vitro and in vivo function validation.
LEARN MORE SOLUTION