Close

Anti-ANO1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-291-YC)


All products and services are For Research Use Only and CANNOT be used in the treatment or diagnosis of disease.

This product is the plasmid containing an encoded anti-ANO1 DMAb sequence. The plasmid can drive transcription and in vivo translation of the desired antibody.

  Add to Cart

Specifications

  • Target
  • ANO1
  • Vector Name
  • pVAX1
  • Vector Description
  • pVAX1 was originally designed for the development of DNA vaccines. Its eukaryotic DNA sequences limited to the expression of desired sequence so that minimize the possibility of chromosomal integration. This vector has been widely used for the construction of DMAb plasmid.
  • Vector Promoter
  • CMV
  • Vector Tag or Fusion
  • Untagged
  • Delivery Method
  • Transfection
  • Cloning Method
  • Restriction Enzyme ⁄ MCS
  • Constitutive or Inducible System
  • Constitutive
  • Storage
  • Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term.
  • Background
  • DNA-encoded mAb (DMAb) technology is a novel approach for a direct in vivo production of desired biologically active immunoglobulins according to the plasmid DNA delivery into tissue where the delivered plasmid containing an encoded antibody sequence. Compared with the traditional mAb, DMAb can be functionally equivalent with additional advantages such as expression profiles, glycosylation, as well as no reliance on in vivo tissue culture and costly or time-consuming production systems. The DMAb technology may provide a novel, simple, less frequent, cost-effective approach for therapeutics.

Target

Sub CAT. DMAb Clone DMAb Host Target Species DMAb Isotype DMAb Immunogen  
DMAb-291-YC DOG-1.1 Mouse Human IgG1, κ A synthetic peptide from human DOG1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein
DMAb-292-YC DG1/1484 Mouse Human IgG2b, κ A recombinant human protein corresponding to amino acids 2-101 of human DOG1/ANO1
DMAb-293-YC DG1/1485 Mouse Human IgG2b, κ A recombinant human protein corresponding to amino acids 2-101 of human DOG1
DMAb-294-YC DG1/1486 Mouse Human IgG2b, κ A recombinant human protein corresponding to amino acids 2-101 of human DOG1
DMAb-295-YC DG1/447 Mouse Human IgG1, κ
DMAb-296-YC SPM580 Mouse Human IgG1, κ
DMAb-297-YC tDAN4 Mouse Human IgG1, κ Recombinant human protein
DMAb-298-YC 10A20 Rabbit Human IgG Synthetic peptide of human Dog1
DMAb-299-YC DG1/1487R Rabbit Human IgG A recombinant human full length protein
DMAb-300-YC SP31 Rabbit Human IgG Synthetic peptides of human DOG-1 protein
DMAb-0177-YJ DG1447 Mouse Human IgG1 Recombinant full length protein corresponding to Human TMEM16A aa 1-986.

Customer Reviews and Q&As

There are currently no customer reviews or questions for Anti-ANO1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-291-YC). Click the button below to contact us or submit your feedback about this product.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Related Products

Online Inquiry

For any technical issues or product/service related questions, please leave your information below. Our team will contact you soon.

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Key Updates
Newsletter NEWSLETTER

The latest newsletter to introduce the latest breaking information, our site updates, field and other scientific news, important events, and insights from industry leaders

LEARN MORE NEWSLETTER
New Solution NEW SOLUTION

CellRapeutics™ In Vivo Cell Engineering: One-stop in vivo T/B/NK cell and macrophage engineering services covering vectors construction to function verification.

LEARN MORE SOLUTION
NOVEL SOLUTION NOVEL TECHNOLOGY

Silence™ CAR-T Cell: A novel platform to enhance CAR-T cell immunotherapy by combining RNAi technology to suppress genes that may impede CAR functionality.

LEARN MORE NOVEL TECHNOLOGY
NEW TECHNOLOGY NEW SOLUTION

Canine CAR-T Therapy Development: From early target discovery, CAR design and construction, cell culture, and transfection, to in vitro and in vivo function validation.

LEARN MORE SOLUTION
Receive our latest news and insights.