Anti-APP DNA-encoded mAb (DMAb), pVAX1 (DMAb-0110-CN)

Online Inquiry  Datasheet

All products and services are For Research Use Only and CANNOT be used in the treatment or diagnosis of disease.

This product is the plasmid containing an encoded anti-APP DMAb sequence. The plasmid can drive transcription and in vivo translation of the desired antibody.

  Add to Cart

Specifications

  • Target
  • APP
  • Vector Name
  • pVAX1
  • Vector Description
  • pVAX1 was originally designed for the development of DNA vaccines. Its eukaryotic DNA sequences limited to the expression of desired sequence so that minimize the possibility of chromosomal integration. This vector has been widely used for the construction of DMAb plasmid.
  • Vector Promoter
  • CMV
  • Vector Tag or Fusion
  • Untagged
  • Delivery Method
  • Transfection
  • Cloning Method
  • Restriction Enzyme ⁄ MCS
  • Constitutive or Inducible System
  • Constitutive
  • Storage
  • Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term.
  • Background
  • DNA-encoded mAb (DMAb) technology is a novel approach for a direct in vivo production of desired biologically active immunoglobulins according to the plasmid DNA delivery into tissue where the delivered plasmid containing an encoded antibody sequence. Compared with the traditional mAb, DMAb can be functionally equivalent with additional advantages such as expression profiles, glycosylation, as well as no reliance on in vivo tissue culture and costly or time-consuming production systems. The DMAb technology may provide a novel, simple, less frequent, cost-effective approach for therapeutics.

Target

  • Entrez Gene ID
  • 351
Sub CAT. DMAb Clone DMAb Host Target Species DMAb Isotype DMAb Immunogen  
DMAb-0110-CN 5-4D-3B Mouse Human IgG1 Human serum amyloid P
DMAb-0111-CN 5H10A10 Mouse Human IgG2b Recombinant fragment corresponding to Human Amyloid beta precursor protein aa. 483-699. (Purified from E. coli).
Sequence: VPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPAN TENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNK
DMAb-0112-CN 22C11 Mouse IgG1, κ
DMAb-0113-CN 3E9 Mouse IgG1 Synthetic peptide corresponding to residues L(18) E V P T D G N A G L L A E P Q I A M F C(38) of human Amyloid Precursor Protein.
DMAb-0114-CN mAbP2-1 Mouse IgG1 Native, secreted form of APP
DMAb-0078-CN 12F4 Mouse IgG1

Customer Reviews and Q&As

There are currently no customer reviews or questions for Anti-APP DNA-encoded mAb (DMAb), pVAX1 (DMAb-0110-CN). Click the button below to contact us or submit your feedback about this product.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Related Products

Online Inquiry

For any technical issues or product/service related questions, please leave your information below. Our team will contact you soon.

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Key Updates
Newsletter. (Creative Biolabs Authorized) NEWSLETTER

The latest newsletter to introduce the latest breaking information, our site updates, field and other scientific news, important events, and insights from industry leaders

LEARN MORE NEWSLETTER
New Solution. (Creative Biolabs Authorized) NEW SOLUTION

CellRapeutics™ In Vivo Cell Engineering: One-stop in vivo T/B/NK cell and macrophage engineering services covering vectors construction to function verification.

LEARN MORE SOLUTION
Novel Solution. (Creative Biolabs Authorized) NOVEL TECHNOLOGY

Silence™ CAR-T Cell: A novel platform to enhance CAR-T cell immunotherapy by combining RNAi technology to suppress genes that may impede CAR functionality.

LEARN MORE NOVEL TECHNOLOGY
New Technology. (Creative Biolabs Authorized) NEW SOLUTION

Canine CAR-T Therapy Development: From early target discovery, CAR design and construction, cell culture, and transfection, to in vitro and in vivo function validation.

LEARN MORE SOLUTION
Receive our latest news and insights.