Anti-ESR1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-014-YC)

Online Inquiry  Datasheet

All products and services are For Research Use Only and CANNOT be used in the treatment or diagnosis of disease.

This product is the plasmid containing an encoded anti-ESR1 DMAb sequence. The plasmid can drive transcription and in vivo translation of the desired antibody.

  Add to Cart

Specifications

  • Target
  • ESR1
  • Vector Name
  • pVAX1
  • Vector Description
  • pVAX1 was originally designed for the development of DNA vaccines. Its eukaryotic DNA sequences limited to the expression of desired sequence so that minimize the possibility of chromosomal integration. This vector has been widely used for the construction of DMAb plasmid.
  • Vector Promoter
  • CMV
  • Vector Tag or Fusion
  • Untagged
  • Delivery Method
  • Transfection
  • Cloning Method
  • Restriction Enzyme ⁄ MCS
  • Constitutive or Inducible System
  • Constitutive
  • Storage
  • Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term.
  • Background
  • DNA-encoded mAb (DMAb) technology is a novel approach for a direct in vivo production of desired biologically active immunoglobulins according to the plasmid DNA delivery into tissue where the delivered plasmid containing an encoded antibody sequence. Compared with the traditional mAb, DMAb can be functionally equivalent with additional advantages such as expression profiles, glycosylation, as well as no reliance on in vivo tissue culture and costly or time-consuming production systems. The DMAb technology may provide a novel, simple, less frequent, cost-effective approach for therapeutics.

Target

  • Entrez Gene ID
  • 2099
Sub CAT. DMAb Clone DMAb Host Target Species DMAb Isotype DMAb Immunogen  
DMAb-014-YC 1A12 Mouse Human IgG2b Recombinant protein
DMAb-0370-FY 415CT16.3.2.1 Mouse Human IgG1
DMAb-0371-FY 5D4B1; 5D4E3 Mouse Human IgG2b Purified recombinant fragment of ER expressed in E.coli
DMAb-0372-FY 5D4E3 Mouse Human IgG2b Ni-NTA purified truncated recombinant ER expressed in E.coli strain BL21
DMAb-0373-FY 6F11-C3-G6 Mouse Human IgG2b A human recombinant protein was used as the immunogen for this Estrogen Receptor alpha antibody
DMAb-0374-FY 8H9A10 Mouse Human IgG1
DMAb-0376-FY AER314 Mouse Cattle IgG1, λ Purified, SDS-denatured calf uterus estrogen receptor. ImmunogenType: Purified protein
DMAb-0378-FY C.15200009 Mouse Human IgG3 The exact immunogen is propietary information
DMAb-0379-FY CL1196 Mouse Human IgG1 This antibody was developed against a recombinant protein corresponding to amino acids: FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
DMAb-0380-FY EPR4097 Rabbit Human IgG
DMAb-0382-FY ER506 Mouse Human IgG1, κ
DMAb-0384-FY ER-B10 Mouse Human IgM
DMAb-0385-FY ER-HR3 Rat Mouse IgG2c Adherent F1 bone marrow stormal cells
DMAb-0386-FY ER-MP54 Rat Mouse IgG1 Balb/c macrophage precursor cell hybrids
DMAb-0389-FY ESR1/420 Mouse Human IgG2a Recombinant human ESR1 protein
DMAb-0390-FY EVG F9 Mouse Mix of synthetic peptides corresponding to residuesT V R E A G P P A F Y R P N S & E V G M M K G G I R K D R R G G R of human ER alpha
DMAb-0391-FY H4624 Mouse Human IgG2a Recombinant human ER alpha/NR3A1, aa 2-180
DMAb-0392-FY NR3Ga-3 Mouse Human IgG1, κ Recombinant human ER alpha protein was used as the immunogen
DMAb-0393-FY OTI8E9 Mouse Human IgG2b Human recombinant protein fragment corresponding to amino acids 1-310 of human ESR1 produced in E.coli
DMAb-0394-FY RM292 Rabbit Human IgG A peptide corresponding to residues near the N-terminus of human ER-alpha
DMAb-0395-FY tbykt Mouse Human IgG1, κ

Customer Reviews and Q&As

There are currently no customer reviews or questions for Anti-ESR1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-014-YC). Click the button below to contact us or submit your feedback about this product.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Related Products

Online Inquiry

For any technical issues or product/service related questions, please leave your information below. Our team will contact you soon.

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Key Updates
Newsletter. (Creative Biolabs Authorized) NEWSLETTER

The latest newsletter to introduce the latest breaking information, our site updates, field and other scientific news, important events, and insights from industry leaders

LEARN MORE NEWSLETTER
New Solution. (Creative Biolabs Authorized) NEW SOLUTION

CellRapeutics™ In Vivo Cell Engineering: One-stop in vivo T/B/NK cell and macrophage engineering services covering vectors construction to function verification.

LEARN MORE SOLUTION
Novel Solution. (Creative Biolabs Authorized) NOVEL TECHNOLOGY

Silence™ CAR-T Cell: A novel platform to enhance CAR-T cell immunotherapy by combining RNAi technology to suppress genes that may impede CAR functionality.

LEARN MORE NOVEL TECHNOLOGY
New Technology. (Creative Biolabs Authorized) NEW SOLUTION

Canine CAR-T Therapy Development: From early target discovery, CAR design and construction, cell culture, and transfection, to in vitro and in vivo function validation.

LEARN MORE SOLUTION
Receive our latest news and insights.