Anti-ESR1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-014-YC)

Datasheet

All products and services are For Research Use Only and CANNOT be used in the treatment or diagnosis of disease.

This product is the plasmid containing an encoded anti-ESR1 DMAb sequence. The plasmid can drive transcription and in vivo translation of the desired antibody.

Add to Cart

Specifications

Target
ESR1

Vector Name
pVAX1

Vector Description
pVAX1 was originally designed for the development of DNA vaccines. Its eukaryotic DNA sequences limited to the expression of desired sequence so that minimize the possibility of chromosomal integration. This vector has been widely used for the construction of DMAb plasmid.

Vector Promoter
CMV

Vector Tag or Fusion
Untagged

Delivery Method
Transfection

Cloning Method
Restriction Enzyme ⁄ MCS

Constitutive or Inducible System
Constitutive

Storage
Store at 4°C short term (1-2 weeks). Aliquot and store at -20°C long term.

Background
DNA-encoded mAb (DMAb) technology is a novel approach for a direct in vivo production of desired biologically active immunoglobulins according to the plasmid DNA delivery into tissue where the delivered plasmid containing an encoded antibody sequence. Compared with the traditional mAb, DMAb can be functionally equivalent with additional advantages such as expression profiles, glycosylation, as well as no reliance on in vivo tissue culture and costly or time-consuming production systems. The DMAb technology may provide a novel, simple, less frequent, cost-effective approach for therapeutics.

Target

Entrez Gene ID
2099

UniProt ID
P03372

Sub CAT.	DMAb Clone	DMAb Host	Target Species	DMAb Isotype	DMAb Immunogen
DMAb-014-YC	1A12	Mouse	Human	IgG2b	Recombinant protein
DMAb-0368-FY	0-N-287	Mouse	Human	IgG1	GST fusion protein corresponding to residues 302-595 of human ER
DMAb-0369-FY	3F173 + 5G102	Mouse		IgG1, κ, IgG1	Recombinant human estrogen receptor protein
DMAb-0370-FY	415CT16.3.2.1	Mouse	Human	IgG1
DMAb-0371-FY	5D4B1; 5D4E3	Mouse	Human	IgG2b	Purified recombinant fragment of ER expressed in E.coli
DMAb-0372-FY	5D4E3	Mouse	Human	IgG2b	Ni-NTA purified truncated recombinant ER expressed in E.coli strain BL21
DMAb-0373-FY	6F11-C3-G6	Mouse	Human	IgG2b	A human recombinant protein was used as the immunogen for this Estrogen Receptor alpha antibody
DMAb-0374-FY	8H9A10	Mouse	Human	IgG1
DMAb-0375-FY	AER304	Mouse	Human	IgG1	The antibody AER304 is directed against estrogen receptor alpha and recognises amino acids residues 120-170, an epitope located in the B domain of ERalpha
DMAb-0376-FY	AER314	Mouse	Cattle	IgG1, λ	Purified, SDS-denatured calf uterus estrogen receptor. ImmunogenType: Purified protein
DMAb-0377-FY	B405 AER311	Mouse		IgG2a	Estrogen receptor antigens purified from calf uterus
DMAb-0378-FY	C.15200009	Mouse	Human	IgG3	The exact immunogen is propietary information
DMAb-0379-FY	CL1196	Mouse	Human	IgG1	This antibody was developed against a recombinant protein corresponding to amino acids: FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
DMAb-0380-FY	EPR4097	Rabbit	Human	IgG
DMAb-133-YC	ER505	Mouse	Human	IgG1, κ	Recombinant human Estrogen Receptor alpha protein
DMAb-0382-FY	ER506	Mouse	Human	IgG1, κ
DMAb-0383-FY	ERa078	Mouse	Human	IgG1
DMAb-0384-FY	ER-B10	Mouse	Human	IgM
DMAb-0385-FY	ER-HR3	Rat	Mouse	IgG2c	Adherent F1 bone marrow stormal cells
DMAb-0386-FY	ER-MP54	Rat	Mouse	IgG1	Balb/c macrophage precursor cell hybrids
DMAb-0387-FY	ER-MP58	Rat	Mouse	IgG2a
DMAb-0388-FY	ER-TR7	Rat	Mouse	IgG2a
DMAb-0389-FY	ESR1/420	Mouse	Human	IgG2a	Recombinant human ESR1 protein
DMAb-0390-FY	EVG F9	Mouse			Mix of synthetic peptides corresponding to residuesT V R E A G P P A F Y R P N S & E V G M M K G G I R K D R R G G R of human ER alpha
DMAb-0391-FY	H4624	Mouse	Human	IgG2a	Recombinant human ER alpha/NR3A1, aa 2-180
DMAb-0392-FY	NR3Ga-3	Mouse	Human	IgG1, κ	Recombinant human ER alpha protein was used as the immunogen
DMAb-0393-FY	OTI8E9	Mouse	Human	IgG2b	Human recombinant protein fragment corresponding to amino acids 1-310 of human ESR1 produced in E.coli
DMAb-0394-FY	RM292	Rabbit	Human	IgG	A peptide corresponding to residues near the N-terminus of human ER-alpha
DMAb-0395-FY	tbykt	Mouse	Human	IgG1, κ

Customer Reviews and Q&As

There are currently no customer reviews or questions for Anti-ESR1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-014-YC). Click the button below to contact us or submit your feedback about this product.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Anti-ESR1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-014-YC)

Specifications

Target

Customer Reviews and Q&As

Related Products

CAR Vector Products