Adrenomedullin (1-52) (Porcine)
Cat. No.: TDLD-0126-LD921
Adrenomedullin (1-52) (Porcine)
Adrenomedullin (porcine) is a therapeutic peptide that regulates vasodilation, inducing endothelium-dependent rat aortic and endothelium-independent porcine coronary artery relaxation. Please note that this product is intended for research purposes only.
Inquiry
SPECIFIC INQUIRY
Clear All
For Research Use Only. Not for Diagnostic or Treatment Applications.
| Category | Therapeutic Peptides |
| CAS | 912862-96-5 |
| Formula | C₂₆₂H₄₀₃N₇₉O₇₆S₃ |
| Molecular Weight | 5971.68 |
| Sequence (1-letter) | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (trifluoroacetate salt) (Cys16 and 21 bridge) |
| Sequence (3-letter) | Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Cys16 and 21 bridge) |
| Purity | >95% |
| Form | Solid/Powder |
| Shipping | Ice pack |
| Storage | Store at -20°C. Keep dry and protect from light. |
| Shelf Life | One Year |
Click the button below to contact us or submit your feedback about this product.
Customer Reviews and Q&As
Related Products
Click MAP (TDLD-0126-LD991)
Peptide C105Y (TDLD-0126-LD1168)
GE11 (TDLD-0126-LD1083)
T7 Tag (TDLD-0126-LD1214)
CNP-53 (Human) (TDLD-0126-LD1002)
Cys-RGD (TDLD-0126-LD1024)
PR-39 (TDLD-0126-LD1174)
Adrenomedullin (1-52) (Human) (TDLD-0126-LD920)
Online Inquiry
