There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Autographa californica nuclear polyhedrosis virus (AcMNPV) Major envelope glycoprotein (21-481 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Autographa californica nuclear polyhedrosis virus (AcMNPV) |
| Fragment | 21-481 aa |
| Sequence | AEHCNAQMKTGPYKIKNLDITPPKETLQKDVEITIVETDYNENVIIGYKGYYQAYAYNGGSLDPNTRVEETMKTLNVGKEDLLMWSIRQQCEVGEELIDRWGSDSDDCFRDNEGRGQWVK GKELVKRQNNNHFAHHTCNKSWRCGISTSKMYSRLECQDDTDECQVYILDAEGNPINVTVDTVLHRDGVSMILKQKSTFTTRQIKAACLLIKDDKNNPESVTREHCLIDNDIYDLSKNTW NCKFNRCIKRKVEHRVKKRPPTWRHNVRAKYTEGDTATKGDLMHIQEELMYENDLLKMNIELMHAHINKLNNMLHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTNPPAHTS NCYNNSIYKEGRWVANTDSSQCIDFSNYKELAIDDDVEFWIPTIGNTTYHDSWKDASGWSFIAQQKSNLITTMENTKFGGVGTSLSDITSMAEGELAAKLT |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Biotin |
| Target | GP64 |
| Full Name | Major envelope glycoprotein |
| Uniprot ID | P17501 |
| Background | Class III viral fusion protein. Envelope phosphoglycoprotein which mediates the fusion of viral and host endosomal membranes leading to virus entry into the host cell. After receptor-mediated internalization of the virus, gp64 undergoes conformational change into a fusion-competent state at low pH, and the nucleocapsid is released into the cytoplasm after cell fusion. May also play role in budding. |
| Alternate Names | GP64; GP67; ORF128; Major envelope glycoprotein; gp64 |