Recombinant Chinese hamster Lysosome-associated membrane glycoprotein 2 (LAMP2) (29-410 aa), E. coli (CAT#: GPX04-065J)

Product Overview	Recombinant Chinese hamster Lysosome-associated membrane glycoprotein 2 (NP_001233678.1) (29-410 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Chinese hamster
Fragment	29-410 aa
Sequence	FELNLPDSKATCLFAKWKMNFTISYETTTNKTLKTVTISEPHNVTYNGSSCGDDQGVAKIAVQFGSTVSWNVTFTKEESHYVIGSIWLVYNTSDNTTFPGAIPKGSATVISSQSIEIPLDDIFRCNSLLTFKTGNVVQNYWDIHLQAFVQNGTVSKEEFVCEEDKSVTTVRPIIHTTVPPPTTTPTPLPPKVGNYSVSNGNATCLLATMGLQLNVTEEKVPFIFNINPSTTNFTGSCHPQTAQLRLNNSQIKYLDFIFAVKSESHFYLKEVNVSMYMANGSVFSVANNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTKGKYATAQDCSADEDNFLVPIAVGAALAGVLALVLLAYFIGLKRHHTGYEQF
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	LAMP2
Full Name	Lysosome-associated membrane glycoprotein 2
Gene ID	100689316
Uniprot ID	P49130
Accession Number	NP_001233678.1
Background	Plays an important role in chaperone-mediated autophagy, a process that mediates lysosomal degradation of proteins in response to various stresses and as part of the normal turnover of proteins with a long biological half-live.
Alternate Names	Lysosome-associated membrane glycoprotein 2