Recombinant Human herpesvirus 4 (HHV-4) (strain GD1) Glycoprotein 42 (BZLF2) (34-223 aa) [6xHis-tag ], E. coli (CAT#: GPX04-195J)

Product Overview	Recombinant Human herpesvirus 4 (HHV-4) (strain GD1) Glycoprotein 42 (34-223 aa) was expressed in E. coli with 6xHis-tag. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 4 (HHV-4) (strain GD1)
Fragment	34-223 aa
Sequence	GGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Tag	6xHis-tag at the N-terminus and 6xHis-tag at the C-terminus
Predicted MW	28.3 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	BZLF2
Full Name	Glycoprotein 42
Uniprot ID	P0C6Z5
Background	Plays a role in virion attachment to host B-lymphocytes, through binding to leukocyte antigen (HLA) class II and subsequently participates in fusion of the virion with host membranes. May act as a tropism switch that directs fusion with B-lymphocytes and inhibits fusion with epithelial cells.
Alternate Names	Glycoprotein 42