Recombinant Mouse Thy-1 membrane glycoprotein (THY1) (20-131 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-295J)

Name: Recombinant Mouse Thy-1 membrane glycoprotein (THY1) (20-131 aa) [6xHis-SUMO-tag], E. coli
SKU: GPX04-295J
Rating: 5 (1 reviews)

Datasheet

Product Overview	Recombinant Mouse Thy-1 membrane glycoprotein (NP_033408.1) (20-131 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	20-131 aa
Sequence	QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
Tag	6xHis-SUMO-tag at the N-terminus
Predicted MW	28.8 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	THY1
Full Name	Thy-1 membrane glycoprotein
Gene ID	21838
Uniprot ID	P01831
Accession Number	NP_033408.1
Background	May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Alternate Names	Thy-1 membrane glycoprotein; Thy-1; CD90 antigen

For Research Use Only.

Online Inquiry

Follow us on

Specifications