Recombinant Sumatran orangutan Neuronal membrane glycoprotein M9-a (GPM6A) (1-278 aa), E. coli (CAT#: GPX04-423J)

Product Overview	Recombinant Sumatran orangutan Neuronal membrane glycoprotein M9-a (NP_001125689.1) (1-278 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Sumatran orangutan
Fragment	1-278 aa
Sequence	MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT YFEMARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQF GIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GPM6A
Full Name	Neuronal membrane glycoprotein M9-a
Gene ID	100172611
Uniprot ID	Q5R9Q3
Accession Number	NP_001125689.1
Background	Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation.
Alternate Names	M6a; GPM6A