There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Sumatran orangutan Neuronal membrane glycoprotein M9-a (NP_001125689.1) (1-278 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Sumatran orangutan |
| Fragment | 1-278 aa |
| Sequence | MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT YFEMARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQF GIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | GPM6A |
| Full Name | Neuronal membrane glycoprotein M9-a |
| Gene ID | 100172611 |
| Uniprot ID | Q5R9Q3 |
| Accession Number | NP_001125689.1 |
| Background | Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. |
| Alternate Names | M6a; GPM6A |