0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Trypanosoma brucei brucei Variant surface glycoprotein ILTAT 1.21 (VSG) (22-454 aa) [His-tag], Baculovirus (CAT#: GP03-440J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Trypanosoma brucei brucei Variant surface glycoprotein ILTAT 1.21 (22-454 aa) was expressed in Baculovirus with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source Baculovirus
Species Trypanosoma brucei brucei
Fragment 22-454 aa
Sequence AVGDAFPAFAVLCAAWDAATNKQIKPWSEDRELPELNDIYNMNMSIASEEWQTIFDGQAEQQTWSQFAQANAGKYKGIDWKQNWDRWRKQRQQTKDAGGAWQTKNHRPEWAATPRDVRPVILAIAEEATELSRKLEPPRTADGKDLIAEINSKLASARCSGELKAAAGNIGCTGPEGTPDKTTTCTTAKAGGSIGHDMLCLCSVAEATDKCSSTGVGDAVPNSGEKLRSNGFQHIVARCPKGPESGTLPQAIDLALAMLATALGTQQPGSNNMILGKSGGGTCTATNSACVDYHEKFSKQQAGITGIPWVALLQQARALYGTYVDAKLAAQTARQQIVMLAGQAKREYRRPAGSLKDPAGVIQEQATNRRRHGADDTNQCTSNNATADECPETRCEYDSEKNECRPKKGTETTATGPGERTTPADGKANNTVS
Tag His-tag at the N-terminus
Predicted MW 48.4 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target VSG
Full Name Variant surface glycoprotein ILTAT 1.21
Uniprot ID P26326
Background VSG forms a coat on the surface of the parasite. The trypanosome evades the immune response of the host by expressing a series of antigenically distinct VSGs from an estimated 1000 VSG genes.
Alternate Names Variant surface glycoprotein ILTAT 1.21
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving