0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Trypanosoma brucei rhodesiense Variant surface glycoprotein ETAT 1.2 (VSG) (1-38 aa) [His-tag], E. coli, Biotin labelled (CAT#: GP03-424J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Trypanosoma brucei rhodesiense Variant surface glycoprotein ETAT 1.2 (1-38 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Trypanosoma brucei rhodesiense
Fragment 1-38 aa
Sequence KNTGRRPNYRECEMRDGECNAKVAKTAEPDSKTNTTGN
Tag His-tag at the N-terminus
Predicted MW 6.2 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Biotin
Target VSG
Full Name Variant surface glycoprotein ETAT 1.2
Uniprot ID P26335
Background VSG forms a coat on the surface of the parasite. The trypanosome evades the immune response of the host by expressing a series of antigenically distinct VSGs from an estimated 1000 VSG genes.
Alternate Names Variant surface glycoprotein ETAT 1.2
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving