Recombinant Trypanosoma congolense Variant surface glycoprotein YnAT 1.3 (VSG) (23-379 aa) [His-tag], Yeast (CAT#: GP03-511J)

Product Overview	Recombinant Trypanosoma congolense Variant surface glycoprotein YnAT 1.3 (23-379 aa) was expressed in Yeast with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Yeast
Species	Trypanosoma congolense
Fragment	23-379 aa
Sequence	TQIIKNTQEFTSLCTFVKVTLKATDGLTSAASKSQTDWALGENPTSRIKKLITELETSSDRIRLGEEPNLTIQLPQGDPKQRLRRKLEVFLARAKYTEELVRQAQGDVGGRCNEAKAELEEAVTGRKGPDLETQATAAAAALHNKARGTACKVAGATTDTNFAGTSLVADLMCLCAAETNSREKHICGFESHASGVWANAGTNSNAGEIWGKILDACKNREIQVEVTPQFLRIAITKFEGLLGAQAHKLTSNGNAGAWLLGYSMNAGSVTCDGQSSTNGICVDYKGSSDARGPIAWLGHIKNAITALENRDKNLQRVRKLQRQAEAILMSAEDALIEANISLGGKDMVPASEVTVPN
Tag	His-tag at the N-terminus
Predicted MW	40.2 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	VSG
Full Name	Variant surface glycoprotein YnAT 1.3
Uniprot ID	P20949
Background	VSG forms a coat on the surface of the parasite. The trypanosome evades the immune response of the host by expressing a series of antigenically distinct VSGs from an estimated 1000 VSG genes.
Alternate Names	Variant surface glycoprotein YnAT 1.3