Recombinant AcMNPV Major envelope glycoprotein (GP64) (21-481 aa), Yeast (CAT#: GPX-172-Y-J)

Product Overview	Recombinant Autographa californica nuclear polyhedrosis virus (AcMNPV) Major envelope glycoprotein (21-481 aa) was expressed in Yeast with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Yeast
Species	Autographa californica nuclear polyhedrosis virus (AcMNPV)
Fragment	21-481 aa
Sequence	AEHCNAQMKTGPYKIKNLDITPPKETLQKDVEITIVETDYNENVIIGYKGYYQAYAYNGGSLDPNTRVEETMKTLNVGKEDLLMWSIRQQCEVGEELIDRWGSDSDDCFRDNEGRGQWVK GKELVKRQNNNHFAHHTCNKSWRCGISTSKMYSRLECQDDTDECQVYILDAEGNPINVTVDTVLHRDGVSMILKQKSTFTTRQIKAACLLIKDDKNNPESVTREHCLIDNDIYDLSKNTW NCKFNRCIKRKVEHRVKKRPPTWRHNVRAKYTEGDTATKGDLMHIQEELMYENDLLKMNIELMHAHINKLNNMLHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTNPPAHTS NCYNNSIYKEGRWVANTDSSQCIDFSNYKELAIDDDVEFWIPTIGNTTYHDSWKDASGWSFIAQQKSNLITTMENTKFGGVGTSLSDITSMAEGELAAKLT
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GP64
Full Name	Major envelope glycoprotein
Uniprot ID	P17501
Background	Class III viral fusion protein. Envelope phosphoglycoprotein which mediates the fusion of viral and host endosomal membranes leading to virus entry into the host cell. After receptor-mediated internalization of the virus, gp64 undergoes conformational change into a fusion-competent state at low pH, and the nucleocapsid is released into the cytoplasm after cell fusion. May also play role in budding.
Alternate Names	GP64; GP67; ORF128; Major envelope glycoprotein; gp64