Recombinant HHV-5 (strain AD169) Unique short US7 glycoprotein (US7) (18-225 aa), Baculovirus (CAT#: GPX-093-B-J)

Product Overview	Recombinant Human herpesvirus 5 (strain AD169) (HHV-5) Unique short US7 glycoprotein (18-225 aa) was expressed in Baculovirus with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Baculovirus
Species	Human herpesvirus 5 (strain AD169) (HHV-5)
Fragment	18-225 aa
Sequence	TRVEDMATFRTEKQWQQDLQYRREFVKRQLAPKPKSNIVVSHTVSCVIDGGNMTSVWRFE GQFNPHIASEVILHDTSGLYNVPHEIQNDGQVLTVTVKRSAPADIAKVLISLKPVQLSSG QYECRPQLQLPWVPRPSSFMYDSYRLWYEKRWLTIILYVFMWTYLVTLLQYCIVRFIGTR LFYFLQRNITIRFTGKPTYNLLTYPVKG
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	US7
Full Name	Unique short US7 glycoprotein
Uniprot ID	P09731
Background	Human cytomegalovirus (HCMV) expresses a large number of membrane proteins with unknown functions. The unique short (US) component of the human cytomegalovirus (HCMV) genome contains a region of genes, US2 to US11, which is predicted to encode at least eight glycoproteins showing limited homology to one another.
Alternate Names	US7; Unique short US7 glycoprotein; Protein HXLF5