There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Human herpesvirus 5 (strain AD169) (HHV-5) Unique short US7 glycoprotein (18-225 aa) was expressed in Yeast with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | Yeast |
| Species | Human herpesvirus 5 (strain AD169) (HHV-5) |
| Fragment | 18-225 aa |
| Sequence | TRVEDMATFRTEKQWQQDLQYRREFVKRQLAPKPKSNIVVSHTVSCVIDGGNMTSVWRFE GQFNPHIASEVILHDTSGLYNVPHEIQNDGQVLTVTVKRSAPADIAKVLISLKPVQLSSG QYECRPQLQLPWVPRPSSFMYDSYRLWYEKRWLTIILYVFMWTYLVTLLQYCIVRFIGTR LFYFLQRNITIRFTGKPTYNLLTYPVKG |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | US7 |
| Full Name | Unique short US7 glycoprotein |
| Uniprot ID | P09731 |
| Background | Human cytomegalovirus (HCMV) expresses a large number of membrane proteins with unknown functions. The unique short (US) component of the human cytomegalovirus (HCMV) genome contains a region of genes, US2 to US11, which is predicted to encode at least eight glycoproteins showing limited homology to one another. |
| Alternate Names | US7; Unique short US7 glycoprotein; Protein HXLF5 |