0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human T-cell-specific surface glycoprotein CD28 (CD28) (19-152 aa) [hFc-tag], Mammalian cell (CAT#: GPX04-135J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant HumanT-cell-specific surface glycoprotein CD28 (NP_001230006.1) (19-152 aa) was expressed in Mammalian cell with a hFc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source Mammalian cell
Species Human
Fragment 19-152 aa
Sequence NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
Tag hFc-tag at the C-terminus
Predicted MW 44.1 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD28
Full Name T-cell-specific surface glycoprotein CD28
Gene ID 940
Uniprot ID P10747
Accession Number NP_001230006.1
Background Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Alternate Names T-cell-specific surface glycoprotein CD28
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving