Recombinant Human T-cell-specific surface glycoprotein CD28 (CD28) (19-152 aa) [hFc-tag], Mammalian cell (CAT#: GPX04-135J)

Product Overview	Recombinant HumanT-cell-specific surface glycoprotein CD28 (NP_001230006.1) (19-152 aa) was expressed in Mammalian cell with a hFc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Mammalian cell
Species	Human
Fragment	19-152 aa
Sequence	NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
Tag	hFc-tag at the C-terminus
Predicted MW	44.1 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD28
Full Name	T-cell-specific surface glycoprotein CD28
Gene ID	940
Uniprot ID	P10747
Accession Number	NP_001230006.1
Background	Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Alternate Names	T-cell-specific surface glycoprotein CD28