Recombinant Mouse T-cell-specific surface glycoprotein CD28 (Cd28) (20-218 aa), E. coli (CAT#: GPX04-311J)

Product Overview	Recombinant Mouse T-cell-specific surface glycoprotein CD28 (12487) (20-218 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	20-218 aa
Sequence	NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Cd28
Full Name	T-cell-specific surface glycoprotein CD28
Gene ID	12487
Uniprot ID	P31041
Accession Number	NP_031668.3
Background	Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Alternate Names	T-cell-specific surface glycoprotein CD28