0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse T-cell surface glycoprotein CD3 zeta chain (CD247) (52-164 aa), Mammalian cell (CAT#: GPX-256-M-J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Mouse T-cell surface glycoprotein CD3 zeta chain (NP_001106862.1) (52-164 aa) was expressed in Mammalian cell with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source Mammalian cell
Species Mouse
Fragment 52-164 aa
Sequence RAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD247
Full Name T-cell surface glycoprotein CD3 zeta chain
Gene ID 12503
Uniprot ID P29020
Accession Number NP_001106862.1
Background Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme.
Alternate Names Cd3; T3z; Cd3h; Cd3z; Tcrk; Tcrz; Cd3-eta; Cd3zeta; AW552088; Cd3-zeta; 4930549J05Rik; A430104F18Rik
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving