Recombinant Sheep T-cell surface glycoprotein CD3 zeta chain (CD247) (22-166 aa), E. coli (CAT#: GPX04-408J)

Product Overview	Recombinant Sheep T-cell surface glycoprotein CD3 zeta chain (NP_001009417.1) (22-166 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Sheep
Fragment	22-166 aa
Sequence	QSFGLLDPKLCYLLDGILFIYGVIVTALFLRAKFSRSADAPAYQHGQNPVYNELNVGRREEYAVLDRRGGFDPEMGGKPQRKKNPHEVVYNELRKDKMAEAYSEIGMKSDNQRRRGKGHDGVYQGLSTATKDTYDALHMQALPPR
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD247
Full Name	T-cell surface glycoprotein CD3 zeta chain
Gene ID	443436
Uniprot ID	P29329
Accession Number	NP_001009417.1
Background	Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response.
Alternate Names	T3 zeta chain; CD247