Recombinant Mouse Epithelial cell adhesion molecule (Epcam) (24-266 aa) [Tag-free], E. coli (CAT#: GP02-034J)

Product Overview	Recombinant Mouse Epithelial cell adhesion molecule (NP_032558.2) (24-266 aa) was expressed in E. coli with Tag-free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Mouse
Fragment	24-266 aa
Sequence	QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Tag	Tag-Free
Predicted MW	27.8 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Epcam
Full Name	Epithelial cell adhesion molecule
Gene ID	17075
Uniprot ID	Q99JW5
Accession Number	NP_032558.2
Background	This protein may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Alternate Names	TR; EGP; EpC; Ly7; gp4; EGP-; Ep-C; EpCA; Ly74; gp40; CD326; EGP-2; Egp31; TROP1; Tacst; Egp314; Ep-CAM; EpCAM1; GA733-; Tacsd1; GA733-2; Tacstd1