Book a Meeting

0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse Epithelial cell adhesion molecule (Epcam) (24-266 aa) [His/Myc-Tag], Mammalian cell (CAT#: GP02-035J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Mouse Epithelial cell adhesion molecule (NP_032558.2) (24-266 aa) was expressed in Mammalian cell with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Mammalian cell
Species Mouse
Fragment 24-266 aa
Sequence QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 32.7 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Epcam
Full Name Epithelial cell adhesion molecule
Gene ID 17075
Uniprot ID Q99JW5
Accession Number NP_032558.2
Background This protein may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Alternate Names TR; EGP; EpC; Ly7; gp4; EGP-; Ep-C; EpCA; Ly74; gp40; CD326; EGP-2; Egp31; TROP1; Tacst; Egp314; Ep-CAM; EpCAM1; GA733-; Tacsd1; GA733-2; Tacstd1
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on