Recombinant Human Epithelial cell adhesion molecule (EPCAM) (24-265 aa) [His-SUMO], E. coli (CAT#: GP02-033J)

Product Overview	Recombinant Human Epithelial cell adhesion molecule (NP_002345.2) (24-265 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human
Fragment	24-265 aa
Sequence	QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Tag	6xHis-SUMO-tag at the N-terminus
Predicted MW	43.4 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	EPCAM
Full Name	Epithelial cell adhesion molecule
Gene ID	4072
Uniprot ID	P16422
Accession Number	NP_002345.2
Background	The protein is a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule.
Alternate Names	ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1