0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Epithelial cell adhesion molecule (EPCAM) (24-265 aa) [His-SUMO], E. coli (CAT#: GP02-033J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human Epithelial cell adhesion molecule (NP_002345.2) (24-265 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 24-265 aa
Sequence QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 43.4 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target EPCAM
Full Name Epithelial cell adhesion molecule
Gene ID 4072
Uniprot ID P16422
Accession Number NP_002345.2
Background The protein is a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule.
Alternate Names ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on