There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 500 μg | ||
| 1 mg |
| Product Overview | Recombinant Trypanosoma congolense Variant surface glycoprotein YnAT 1.3 (23-379 aa) was expressed in HEK 293-F cell with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | HEK 293-F cell |
| Species | Trypanosoma congolense |
| Fragment | 23-379 aa |
| Sequence | TQIIKNTQEFTSLCTFVKVTLKATDGLTSAASKSQTDWALGENPTSRIKKLITELETSSDRIRLGEEPNLTIQLPQGDPKQRLRRKLEVFLARAKYTEELVRQAQGDVGGRCNEAKAELEEAVTGRKGPDLETQATAAAAALHNKARGTACKVAGATTDTNFAGTSLVADLMCLCAAETNSREKHICGFESHASGVWANAGTNSNAGEIWGKILDACKNREIQVEVTPQFLRIAITKFEGLLGAQAHKLTSNGNAGAWLLGYSMNAGSVTCDGQSSTNGICVDYKGSSDARGPIAWLGHIKNAITALENRDKNLQRVRKLQRQAEAILMSAEDALIEANISLGGKDMVPASEVTVPN |
| Tag | His-tag at the N-terminus |
| Predicted MW | 40.2 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | VSG |
| Full Name | Variant surface glycoprotein YnAT 1.3 |
| Uniprot ID | P20949 |
| Background | VSG forms a coat on the surface of the parasite. The trypanosome evades the immune response of the host by expressing a series of antigenically distinct VSGs from an estimated 1000 VSG genes. |
| Alternate Names | Variant surface glycoprotein YnAT 1.3 |