0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Trypanosoma congolense Variant surface glycoprotein YnAT 1.3 (VSG) (23-379 aa) [His-tag], HEK 293-F cell (CAT#: GP03-509J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Trypanosoma congolense Variant surface glycoprotein YnAT 1.3 (23-379 aa) was expressed in HEK 293-F cell with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source HEK 293-F cell
Species Trypanosoma congolense
Fragment 23-379 aa
Sequence TQIIKNTQEFTSLCTFVKVTLKATDGLTSAASKSQTDWALGENPTSRIKKLITELETSSDRIRLGEEPNLTIQLPQGDPKQRLRRKLEVFLARAKYTEELVRQAQGDVGGRCNEAKAELEEAVTGRKGPDLETQATAAAAALHNKARGTACKVAGATTDTNFAGTSLVADLMCLCAAETNSREKHICGFESHASGVWANAGTNSNAGEIWGKILDACKNREIQVEVTPQFLRIAITKFEGLLGAQAHKLTSNGNAGAWLLGYSMNAGSVTCDGQSSTNGICVDYKGSSDARGPIAWLGHIKNAITALENRDKNLQRVRKLQRQAEAILMSAEDALIEANISLGGKDMVPASEVTVPN
Tag His-tag at the N-terminus
Predicted MW 40.2 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target VSG
Full Name Variant surface glycoprotein YnAT 1.3
Uniprot ID P20949
Background VSG forms a coat on the surface of the parasite. The trypanosome evades the immune response of the host by expressing a series of antigenically distinct VSGs from an estimated 1000 VSG genes.
Alternate Names Variant surface glycoprotein YnAT 1.3
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving