Book a Meeting

0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Bovine Alpha-1-acid glycoprotein(AGP) [His-tag and GST-tag], E. coli (CAT#: GP01-010J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Bovine Alpha-1-acid glycoprotein(AGP) (Thr33-Arg195) was expressed in E. coli with a His-tag and GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Bovine
Fragment Thr33-Arg195
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTLEVLFQGPLGSEFTNATMDLLSGKWFYIGSAFRNPEYNKSARAIQAAFFYLEPRHAEDKLITREYQTIEDKCVYNCSFIKIYRQNGTLSKVESDREHFVDLLLSKHFRTFMLAASWNGTKNVGVSFYADKPEVTQEQKKEFLDVIKCIGIQESEIIYTDEKKDACGPLEKQHEEER
Tag His-tag and GST-tag at the N-terminus
Predicted MW 46.1 KDa
Purity >97%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target AGP
Full Name Alpha-1-acid glycoprotein
Uniprot ID Q5GN72
Background This protein functions as transport protein in the blood stream.
Alternate Names AGP; Alpha-1-acid glycoprotein
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on