There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Bovine respiratory syncytial virus (BRSV) (strain 127) Major surface glycoprotein G (1-263 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Bovine respiratory syncytial virus (BRSV) (strain 127) |
| Fragment | 1-263 aa |
| Sequence | MSNHTHHPKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITAII YISVGNAKAKPTSKPTTQQTQQLQNHTPPPLTEHNYKSTHTSIQSTTLSQPPNIDTTSGT TYGHPTNRTQNRKIKSQSTPLATRKPPINPLGSNPPENHQDHNNSQTLPHVPCSTCEGNP ACSPLCQIELERAPSSAPTITLKKAPKPKTTKKPTKTTIYHRTSPEAKLQTKKIMATPQQ GILSSPEHQTNQSTTQISQHTSI |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | G |
| Full Name | Major surface glycoprotein G |
| Uniprot ID | O10683 |
| Background | Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities. |
| Alternate Names | Attachment glycoprotein G; Membrane-bound glycoprotein; mG |