There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg | ||
500 μg | ||
1 mg |
Product Overview | Recombinant Brush-tailed possum Glycoprotein hormones alpha chain (25-120 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Brush-tailed possum |
Fragment | 25-120 aa |
Sequence | FPDGEFIMQGCPECKLKENKYFSKLGAPIYQC mgCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATV mgNAKVENHTECHCSTCYYHKS |
Tag | His-tag at the N-terminus |
Predicted MW | 12.7 kDa |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | CGA |
Full Name | Glycoprotein hormones alpha chain |
Uniprot ID | P68268 |
Background | Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. |
Alternate Names | Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain |