0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Canine Glycoprotein hormones, alpha polypeptide (CGA) (25-120 aa) [His/Myc-Tag], E. coli (CAT#: GP02-019J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Canine Glycoprotein hormones, alpha polypeptide (NP_001002988.1) (25-120 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Canine
Fragment 25-120 aa
Sequence FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 18.1 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CGA
Full Name Glycoprotein hormones, alpha polypeptide
Gene ID 403483
Uniprot ID Q9XSW8
Accession Number NP_001002988.1
Background Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Alternate Names Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Thyrotropin alpha chain
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving