Recombinant Canine Glycoprotein hormones, alpha polypeptide (CGA) (25-120 aa) [His/Myc-Tag], E. coli (CAT#: GP02-019J)

Product Overview	Recombinant Canine Glycoprotein hormones, alpha polypeptide (NP_001002988.1) (25-120 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Canine
Fragment	25-120 aa
Sequence	FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	18.1 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CGA
Full Name	Glycoprotein hormones, alpha polypeptide
Gene ID	403483
Uniprot ID	Q9XSW8
Accession Number	NP_001002988.1
Background	Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Alternate Names	Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Thyrotropin alpha chain