There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 500 μg | ||
| 1 mg |
| Product Overview | Recombinant Common ostrich Glycoprotein hormones alpha chain (1-96 aa) was expressed in HEK 293-F cell with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | HEK 293-F cell |
| Species | Common ostrich |
| Fragment | 1-96 aa |
| Sequence | FPDGEFLMQGCPECKLGENRFFSKPGAPVYQCTGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTECHCSTCYYHKS |
| Tag | His-tag at the N-terminus |
| Predicted MW | 12.7 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | CGA |
| Full Name | Glycoprotein hormones alpha chain |
| Uniprot ID | P80665 |
| Background | Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. |
| Alternate Names | Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain |