0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human adenovirus 35 (HAdV-35) Early E3 18.5 kDa glycoprotein (20-166 aa) [His-tag], E. coli (CAT#: GP03-139J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Human adenovirus 35 (HAdV-35) Early E3 18.5 kDa glycoprotein (20-166 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human adenovirus 35 (HAdV-35)
Fragment 20-166 aa
Sequence NYDPCLDFDPENCTLTFAPDTSRICGVLIKCGWECRSVEITHNNKTWNNTLSTTWEPGVPEWYTVSVRGPDGSIRISNNTFIFSEMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHLLVTTRIKNANNKEKMP
Tag His-tag at the N-terminus
Predicted MW 18.6 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Early E3 18.5 kDa glycoprotein
Full Name Early E3 18.5 kDa glycoprotein
Uniprot ID P68981
Background Early E3 18.5 kDa glycoprotein binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention.
Alternate Names Early E3 18.5 kDa glycoprotein; E3-19K; E19
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving