Recombinant Human adenovirus 35 (HAdV-35) Early E3 18.5 kDa glycoprotein (20-166 aa) [His-tag], E. coli (CAT#: GP03-139J)

Product Overview	Recombinant Human adenovirus 35 (HAdV-35) Early E3 18.5 kDa glycoprotein (20-166 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human adenovirus 35 (HAdV-35)
Fragment	20-166 aa
Sequence	NYDPCLDFDPENCTLTFAPDTSRICGVLIKCGWECRSVEITHNNKTWNNTLSTTWEPGVPEWYTVSVRGPDGSIRISNNTFIFSEMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHLLVTTRIKNANNKEKMP
Tag	His-tag at the N-terminus
Predicted MW	18.6 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Early E3 18.5 kDa glycoprotein
Full Name	Early E3 18.5 kDa glycoprotein
Uniprot ID	P68981
Background	Early E3 18.5 kDa glycoprotein binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention.
Alternate Names	Early E3 18.5 kDa glycoprotein; E3-19K; E19