0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human adenovirus C serotype 2 (HAdV-2) Early E3 18.5 kDa glycoprotein (18-123 aa) [His/Myc-Tag], E. coli (CAT#: GP02-076J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human adenovirus C serotype 2 (HAdV-2) Early E3 18.5 kDa glycoprotein (18-123 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human adenovirus C serotype 2 (HAdV-2)
Fragment 18-123 aa
Sequence AKKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPGDTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQKCLENTG
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 20.0 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Early E3 18.5 kDa glycoprotein
Full Name Early E3 18.5 kDa glycoprotein
Gene ID 2652987
Uniprot ID P68978
Background This protein binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention. Binds transporters associated with antigen processing (TAP) and acts as a tapasin inhibitor, preventing class I/TAP association. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.
Alternate Names E3-19K; E3gp 19 kDa; Short name:; E19; GP19K
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving