0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Alanyl aminopeptidase, membrane (ANPEP) (34-219 aa) [His-GST/Myc-Tag], E. coli (CAT#: GP02-004J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human Alanyl aminopeptidase, membrane (NP_001141.2) (34-219 aa) was expressed in E. coli with a 10xHis-GST-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 34-219 aa
Sequence SQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARK
Tag 10xHis-GST-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 55.8 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target ANPEP
Full Name Alanyl aminopeptidase, membrane
Gene ID 290
Uniprot ID P15144
Accession Number NP_001141.2
Background Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear.
Alternate Names APN; CD13; LAP1; P150; PEPN; GP150
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on