There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 1 mg |
| Product Overview | Recombinant Human Alanyl aminopeptidase, membrane (NP_001141.2) (34-219 aa) was expressed in E. coli with a 10xHis-GST-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Source | E. coli |
| Species | Human |
| Fragment | 34-219 aa |
| Sequence | SQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARK |
| Tag | 10xHis-GST-tag at the N-terminus and Myc-tag at the C-terminus |
| Predicted MW | 55.8 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | ANPEP |
| Full Name | Alanyl aminopeptidase, membrane |
| Gene ID | 290 |
| Uniprot ID | P15144 |
| Accession Number | NP_001141.2 |
| Background | Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. |
| Alternate Names | APN; CD13; LAP1; P150; PEPN; GP150 |