0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human CD177 molecule (CD177) (22-321 aa) [His-GST-Tag], E. coli (CAT#: GP02-006J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human CD177 molecule (NP_065139.2) (22-321 aa) was expressed in E. coli with a 6xHis-GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 22-321 aa
Sequence LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG
Tag 6xHis-GST-tag at the N-terminus
Predicted MW 63.6 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD177
Full Name CD177 molecule
Gene ID 57126
Uniprot ID Q8N6Q3
Accession Number NP_065139.2
Background This protein is a glycosyl-phosphatidylinositol (GPI)-linked cell surface glycoprotein that plays a role in neutrophil activation. The protein can bind platelet endothelial cell adhesion molecule-1 and function in neutrophil transmigration.
Alternate Names NB1; PRV1; HNA2A; PRV-1; HNA-2a; NB1 GP
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on