There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg | ||
1 mg |
Product Overview | Recombinant Human CD177 molecule (NP_065139.2) (22-321 aa) was expressed in E. coli with a 6xHis-GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | E. coli |
Species | Human |
Fragment | 22-321 aa |
Sequence | LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG |
Tag | 6xHis-GST-tag at the N-terminus |
Predicted MW | 63.6 kDa |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | CD177 |
Full Name | CD177 molecule |
Gene ID | 57126 |
Uniprot ID | Q8N6Q3 |
Accession Number | NP_065139.2 |
Background | This protein is a glycosyl-phosphatidylinositol (GPI)-linked cell surface glycoprotein that plays a role in neutrophil activation. The protein can bind platelet endothelial cell adhesion molecule-1 and function in neutrophil transmigration. |
Alternate Names | NB1; PRV1; HNA2A; PRV-1; HNA-2a; NB1 GP |