There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 1 mg |
| Product Overview | Recombinant Human coronavirus 229E (HCoV-229E) Surface glycoprotein (785-873 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Source | E. coli |
| Species | Human coronavirus 229E (HCoV-229E) |
| Fragment | 785-873 aa |
| Sequence | DVLQENQKILAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQLRQNFQAISSSIQAIYDRLDTIQ |
| Tag | 10xHis-tag at the N-terminus and Myc-tag at the C-terminus |
| Predicted MW | 17.2 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | S |
| Full Name | Surface glycoprotein |
| Gene ID | 918758 |
| Uniprot ID | P15423 |
| Background | S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. |
| Alternate Names | S glycoprotein; E2; Peplomer protein; S |