0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human coronavirus 229E (HCoV-229E) Surface glycoprotein (S) (785-873 aa) [His/Myc-Tag], E. coli (CAT#: GP02-087J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human coronavirus 229E (HCoV-229E) Surface glycoprotein (785-873 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human coronavirus 229E (HCoV-229E)
Fragment 785-873 aa
Sequence DVLQENQKILAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQLRQNFQAISSSIQAIYDRLDTIQ
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 17.2 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target S
Full Name Surface glycoprotein
Gene ID 918758
Uniprot ID P15423
Background S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
Alternate Names S glycoprotein; E2; Peplomer protein; S
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on