0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human coronavirus HKU1 (isolate N5) Spike glycoprotein (S) (310-622 aa) [mFC-Tag], Mammalian cell (CAT#: GP02-113J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg

Product Overview Recombinant Human coronavirus HKU1 (isolate N5) Spike glycoprotein (310-622 aa) was expressed in Mammalian cell with a mFC-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Mammalian cell
Species Human coronavirus HKU1 (isolate N5)
Fragment 310-622 aa
Sequence TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNLSSYDVVYSDHCFSVNSDFCPCADPSVVNSCAKSKPPSAICPAGTKYRHCDLDTTLYVKNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHSSCFCSPDAFLGWSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEISTGVCVNY
Tag mFC-tag at the C-terminus
Predicted MW 64.1 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target S
Full Name Spike glycoprotein
Uniprot ID Q0ZME7
Background Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names S glycoprotein; E2; Peplomer protein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving