0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human coronavirus OC43 (HCoV-OC43) Spike glycoprotein (S) (15-344 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-166J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human coronavirus OC43 (HCoV-OC43) Spike glycoprotein (15-344 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human coronavirus OC43 (HCoV-OC43)
Fragment 15-344 aa
Sequence VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 53.6 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target S
Full Name Spike glycoprotein
Uniprot ID P36334
Background Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names E2; Peplomer protein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on