0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Cytochrome b-245 beta chain (CYBB) (283-570 aa) [His-Tag], E. coli (CAT#: GP02-025J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human Cytochrome b-245 beta chain (NP_000388.2) (283-570 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 283-570 aa
Sequence ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Tag 6xHis-tag at the N-terminus
Predicted MW 37.2 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CYBB
Full Name Cytochrome b-245 beta chain
Gene ID 1536
Uniprot ID P04839
Accession Number NP_000388.2
Background Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
Alternate Names CGD; CGDX; NOX2; IMD34; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on