0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 1 (strain 17) Envelope glycoprotein G (25-238 aa) [His-tag], E. coli (CAT#: GP02-156J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Human herpesvirus 1 (strain 17)Envelope glycoprotein G (25-238 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human herpesvirus 1 (strain 17)
Fragment 25-238 aa
Sequence VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG
Tag 10xHis-tag at the N-terminus
Predicted MW 28.8 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Envelope glycoprotein G
Full Name Envelope glycoprotein G
Gene ID 2703404
Uniprot ID P06484
Background This protein is a hemokine-binding protein that inhibits neutrophils' chemotaxis.
Alternate Names gG-1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.