0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein C (gC) (267-359 aa) [His-KSI-Tag], E. coli (CAT#: GP02-044J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein C (267-359 aa) was expressed in E. coli with a 6xHis-KSI-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human herpesvirus 1 (strain KOS)
Fragment 267-359 aa
Sequence PSLTLQPHAVMEGQPFKATCTAAAYYPRNPVEFDWFEDDRQVFNPGQIDTQTHEHPDGFTTVSTVTSEAVGGQVPPRTFTCQMTWHRDSVTFS
Tag 6xHis-KSI-tag at the N-terminus
Predicted MW 25.8 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gC
Full Name Envelope glycoprotein C
Uniprot ID P28986
Background This protein is a major attachment protein that mediates binding of the virus to cell surface heparan sulfate or chondroitin sulfate. Plays also several roles in host immune evasion by inhibiting the host complement cascade activation, and by providing a shield against neutralizing antibodies that interfere with gB-gD, gB-gH/gL or gD-gH/gL interactions.
Alternate Names gC; UL44
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving