0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Envelope glycoprotein L (gL) (23-137 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-189J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Envelope glycoprotein L (23-137 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human herpesvirus 4 (HHV-4) (strain B95-8)
Fragment 23-137 aa
Sequence NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 28.7 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gL
Full Name Envelope glycoprotein L
Gene ID 3783710
Uniprot ID P03212
Background The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form.
Alternate Names Envelope glycoprotein L
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving