Recombinant Human herpesvirus 5 (HHV-5) (strain AD169) Envelope glycoprotein H (gH) (24-195 aa) [6xHis-SUMO-tag], E. coli

Recombinant Human herpesvirus 5 (HHV-5) (strain AD169) Envelope glycoprotein H (24-195 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Determined by its binding ability in a functional ELISA.

Human herpesvirus 5 (HHV-5) (strain AD169)

24-195 aa

RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT

6xHis-SUMO-tag at the N-terminus

35.8 kDa

>90%, determined by SDS-PAGE.

Unconjugated

gH

Envelope glycoprotein H

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Following initial binding to host receptor, membrane fusion is mediated by the fusion machinery composed of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.

gH; UL75