Recombinant Human herpesvirus 6A (strain Uganda-1102) Glycoprotein U23 (U23) (18-236 aa), E. coli (CAT#: GPX04-213J)

Product Overview	Recombinant Human herpesvirus 6A (strain Uganda-1102) Glycoprotein U23 (18-236 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 6A (strain Uganda-1102)
Fragment	18-236 aa
Sequence	LNLMTTEVSATEFASIASKNMETDVSTSSDYLTGKSETTFSANSETWGKNVTEISIDSET YLNQSFMVTSTLAVETTDRSIGNNVNVTSSFPTVKGDETQNIETSFTVISASTFSDVSEK TPQGLSTKSTPKKTVQALWETDTVQVLEFTDTHEGDEEYFKDFLSSLVIWIGGISFIGAF VILIVILCNWYKKDKQRSLFWDEEKKPDVQMRRDVKTCR
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	U23
Full Name	Glycoprotein U23
Uniprot ID	Q69558
Background	U23 protein is expressed at the late phase of infection as a glycoprotein.
Alternate Names	Glycoprotein U23