0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 6B (strain Z29) Putative immediate early glycoprotein (U18) (22-294 aa), E. coli (CAT#: GPX04-220J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human herpesvirus 6B (strain Z29) Putative immediate early glycoprotein (NP_050198.1) (22-294 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human herpesvirus 6B (strain Z29)
Fragment 22-294 aa
Sequence SNLTCEQKIVLIQEQKLGAICISTCYVNGVLAGNSSCVSVRTSYLINLAMLTDGFKAMKV GNITSISEKTAFLRVIINYYFRGVMLRALIAKRLPNAAQLSSTVNCWLEGHSAGGVMTLF YGTERIVLKSSTEMNASQWTSDGPDANGTLNILNERVSLDSYFLSMICPQLSDEIYKKKV VHSKYFSLIKNDTMPKKFLRNTWKSAWTNWYKYKEIEALLDFSRDYENVSEITHSMSAAG LFFLAGGAFTMLLLLCCLSMITRKHVVKDLGYK
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target U18
Full Name Putative immediate early glycoprotein
Gene ID 1497014
Uniprot ID Q9WT46
Accession Number NP_050198.1
Background Human herpesvirus 6 (HHV-6) is the common collective name for human betaherpesvirus 6A (HHV-6A) and human betaherpesvirus 6B (HHV-6B). Human herpesvirus-6 (HHV-6) A and B are ubiquitous betaherpesviruses, infecting the majority of the human population.
Alternate Names Protein U18
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on