Recombinant Human herpesvirus 6B (strain Z29) Putative immediate early glycoprotein (U18) (22-294 aa), E. coli (CAT#: GPX04-220J)

Product Overview	Recombinant Human herpesvirus 6B (strain Z29) Putative immediate early glycoprotein (NP_050198.1) (22-294 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 6B (strain Z29)
Fragment	22-294 aa
Sequence	SNLTCEQKIVLIQEQKLGAICISTCYVNGVLAGNSSCVSVRTSYLINLAMLTDGFKAMKV GNITSISEKTAFLRVIINYYFRGVMLRALIAKRLPNAAQLSSTVNCWLEGHSAGGVMTLF YGTERIVLKSSTEMNASQWTSDGPDANGTLNILNERVSLDSYFLSMICPQLSDEIYKKKV VHSKYFSLIKNDTMPKKFLRNTWKSAWTNWYKYKEIEALLDFSRDYENVSEITHSMSAAG LFFLAGGAFTMLLLLCCLSMITRKHVVKDLGYK
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	U18
Full Name	Putative immediate early glycoprotein
Gene ID	1497014
Uniprot ID	Q9WT46
Accession Number	NP_050198.1
Background	Human herpesvirus 6 (HHV-6) is the common collective name for human betaherpesvirus 6A (HHV-6A) and human betaherpesvirus 6B (HHV-6B). Human herpesvirus-6 (HHV-6) A and B are ubiquitous betaherpesviruses, infecting the majority of the human population.
Alternate Names	Protein U18