0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Pregnancy specific beta-1-glycoprotein 1 (PSG1) [His-tag and T7-tag], E. coli (CAT#: GP01-111J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Pregnancy specific beta-1-glycoprotein 1 (PSG1) (NP_001171754.1) (Leu202-Thr401) was expressed in E. coli with a His-tag and T7-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Leu202-Thr401
Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSAT
Tag His-tag and T7-tag at the N-terminus
Predicted MW 26.7 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target PSG1
Full Name Pregnancy specific beta-1-glycoprotein 1
Gene ID 5669
Uniprot ID P11464
Accession Number NP_001171754.1
Background The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reaching concentrations of 100 to 290 mg/l at term in the serum of pregnant women. PSG is a member of the immunoglobulin (Ig) superfamily.
Alternate Names SP1; B1G1; PBG1; CD66f; PSBG1; PSG95; PSGGA; DHFRP2; PSBG-1; PSGIIA; FL-NCA-1/2; PS-beta-C/D; PS-beta-G-1; PSG1; Pregnancy specific beta-1-glycoprotein 1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving