There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 10 μg | ||
| 50 μg | ||
| 200 μg |
| Product Overview | Recombinant Human Pregnancy specific beta-1-glycoprotein 1 (PSG1) (NP_001171754.1) (Leu202-Thr401) was expressed in E. coli with a His-tag and T7-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Human |
| Fragment | Leu202-Thr401 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSAT |
| Tag | His-tag and T7-tag at the N-terminus |
| Predicted MW | 26.7 KDa |
| Purity | >95%, determined by SDS-PAGE and HPLC |
| Endotoxin Level | <1 EU/μg, determined by the LAL method |
| Conjugation | Unconjugated |
| Target | PSG1 |
| Full Name | Pregnancy specific beta-1-glycoprotein 1 |
| Gene ID | 5669 |
| Uniprot ID | P11464 |
| Accession Number | NP_001171754.1 |
| Background | The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reaching concentrations of 100 to 290 mg/l at term in the serum of pregnant women. PSG is a member of the immunoglobulin (Ig) superfamily. |
| Alternate Names | SP1; B1G1; PBG1; CD66f; PSBG1; PSG95; PSGGA; DHFRP2; PSBG-1; PSGIIA; FL-NCA-1/2; PS-beta-C/D; PS-beta-G-1; PSG1; Pregnancy specific beta-1-glycoprotein 1 |