0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human respiratory syncytial virus B (strain B1) Fusion glycoprotein F0 (F) (137-574 aa) [6xHis-tag], Yeast (CAT#: GPX04-243J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human respiratory syncytial virus B (strain B1) Fusion glycoprotein F0 (NP_056863.1) (137-574 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source Yeast
Species Human respiratory syncytial virus B (strain B1)
Fragment 137-574 aa
Sequence FLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYINNQLLPIVNQQSCRISNIETVIEFQQKNSRLLEINREFSVNAGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPIYGVIDTPCWKLHTSPLCTTNIKEGSNICLTRTDRGWYCDNAGSVSFFPQADTCKVQSNRVFCDTMNSLTLPSEVSLCNTDIFNSKYDCKIMTSKTDISSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEGKNLYVKGEPIINYYDPLVFPSDEFDASISQVNEKINQSLAFIRRSDELLHNVNTGKSTTNIMITTIIIVIIVVLLSLIAIGLLLYCKAKNTPVTLSKDQLSGINNIAFSK
Tag 6xHis-tag at the N-terminus
Predicted MW 50.1 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target F
Full Name Fusion glycoprotein F0
Gene ID 1489825
Uniprot ID O36634
Accession Number NP_056863.1
Background Fusion glycoprotein F0 is an inactive precursor that is cleaved at two sites by a furin-like protease to give rise to the mature F1 and F2 fusion glycoproteins.
Alternate Names Fusion glycoprotein F0 is an inactive precursor that is cleaved at two sites by a furin-like protease to give rise to the mature F1 and F2 fusion glycoproteins.
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving