Recombinant Human respiratory syncytial virus B (strain B1) Major surface glycoprotein G (G) (1-299 aa), E. coli (CAT#: GPX04-244J)

Product Overview	Recombinant Human respiratory syncytial virus B (strain B1) Major surface glycoprotein G (NP_056862.1) (1-299 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human respiratory syncytial virus B (strain B1)
Fragment	1-299 aa
Sequence	MSKHKNQRTARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAMIISTSLIIAAII FIISANHKVTLTTVTVQTIKNHTEKNITTYLTQVPPERVSSSKQPTTTSPIHTNSATTSP NTKSETHHTTAQTKGRTTTSTQTNKPSTKPRLKNPPKKPKDDYHFEVFNFVPCSICGNNQ LCKSICKTIPSNKPKKKPTIKPTNKPTTKTTNKRDPKTPAKTTKKETTTNPTKKPTLTTT ERDTSTSQSTVLDTTTLEHTIQQQSLHSTTPENTPNSTQTPTASEPSTSNSTQNTQSHA
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	G
Full Name	Major surface glycoprotein G
Gene ID	1489824
Uniprot ID	O36633
Accession Number	NP_056862.1
Background	Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities.
Alternate Names	Attachment glycoprotein G; Membrane-bound glycoprotein; mG