0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human respiratory syncytial virus B (strain B1) Major surface glycoprotein G (G) (1-299 aa), E. coli (CAT#: GPX04-244J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human respiratory syncytial virus B (strain B1) Major surface glycoprotein G (NP_056862.1) (1-299 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human respiratory syncytial virus B (strain B1)
Fragment 1-299 aa
Sequence MSKHKNQRTARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAMIISTSLIIAAII FIISANHKVTLTTVTVQTIKNHTEKNITTYLTQVPPERVSSSKQPTTTSPIHTNSATTSP NTKSETHHTTAQTKGRTTTSTQTNKPSTKPRLKNPPKKPKDDYHFEVFNFVPCSICGNNQ LCKSICKTIPSNKPKKKPTIKPTNKPTTKTTNKRDPKTPAKTTKKETTTNPTKKPTLTTT ERDTSTSQSTVLDTTTLEHTIQQQSLHSTTPENTPNSTQTPTASEPSTSNSTQNTQSHA
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target G
Full Name Major surface glycoprotein G
Gene ID 1489824
Uniprot ID O36633
Accession Number NP_056862.1
Background Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities.
Alternate Names Attachment glycoprotein G; Membrane-bound glycoprotein;
mG
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on