0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Vitronectin (VTN) protein [His-Tag], E. coli (CAT#: GP01-148J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Vitronectin (VTN) protein (NP_000629.3) (Thr400-Tyr468) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Thr400-Tyr468
Sequence MGHHHHHHSGSEFTWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQY
Tag His-Tag at the N-terminus
Predicted MW 9.7 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target VTN
Full Name Vitronectin
Gene ID 7448
Uniprot ID P04004
Accession Number NP_000629.3
Background The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands include integrins, plasminogen activator inhibitor-1, and urokinase plasminogen activator receptor. This secreted protein can be present in the plasma as a monomer or dimer and forms a multimer in the extracellular matrix of several tissues. This protein also inhibits the membrane-damaging effect of the terminal cytolytic complement pathway and binds to several serpin serine protease inhibitors. This protein can also promote extracellular matrix degradation and thus plays a role in tumorigenesis. It is involved in a variety of other biological processes such as the regulation of the coagulation pathway, wound healing, and tissue remodeling. The heparin-binding domain of this protein give it anti-microbial properties. It is also a lipid binding protein that forms a principal component of high density lipoprotein.
Alternate Names VN; V75; VNT; Vitronectin
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on