0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Macaca fascicularis T-cell surface glycoprotein cd3 gamma chain (CD3G) (23-113 aa) [His-Tag], Yeast (CAT#: GP02-010J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Macaca fascicularis T-cell surface glycoprotein cd3 gamma chain (23-113 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Yeast
Species Macaca fascicularis
Fragment 23-113 aa
Sequence QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Tag 6xHis-tag at the N-terminus
Predicted MW 12.5 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD3G
Full Name T-cell surface glycoprotein cd3 gamma chain
Gene ID 102134381
Uniprot ID Q95LI7
Background This protein is a part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
Alternate Names CD3GT-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD antigen CD3g
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving