Recombinant Macaca fascicularis T-cell surface glycoprotein cd3 gamma chain (CD3G) (23-113 aa) [His-Tag], Yeast

Recombinant Macaca fascicularis T-cell surface glycoprotein cd3 gamma chain (23-113 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.

Yeast

Macaca fascicularis

23-113 aa

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

6xHis-tag at the N-terminus

12.5 kDa

>95%, determined by SDS-PAGE.

Unconjugated

CD3G

T-cell surface glycoprotein cd3 gamma chain

This protein is a part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.

CD3GT-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD antigen CD3g