There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg |
Product Overview | Recombinant Macaca fascicularis T-cell surface glycoprotein cd3 gamma chain (23-113 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | Yeast |
Species | Macaca fascicularis |
Fragment | 23-113 aa |
Sequence | QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT |
Tag | 6xHis-tag at the N-terminus |
Predicted MW | 12.5 kDa |
Purity | >95%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | CD3G |
Full Name | T-cell surface glycoprotein cd3 gamma chain |
Gene ID | 102134381 |
Uniprot ID | Q95LI7 |
Background | This protein is a part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. |
Alternate Names | CD3GT-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD antigen CD3g |